bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1584_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value At2g44180 41.6 6e-04 At3g59990 38.9 0.004 7297553 33.5 0.17 Hs9910182 30.4 1.2 SPBC14C8.03 29.6 2.4 Hs4757758 27.7 9.2 > At2g44180 Length=431 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 0/27 (0%) Query 113 QQTVPPTKTMQQLFPAGDFPKGEVQLY 139 QQT PP+ + +LFP+GDFP+GE+Q Y Sbjct 69 QQTDPPSIPVLELFPSGDFPQGEIQQY 95 > At3g59990 Length=435 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 0/37 (0%) Query 113 QQTVPPTKTMQQLFPAGDFPKGEVQLYASPPHDAEAR 149 QQT PP+ + +LFP+G+FP+GE+Q Y E R Sbjct 77 QQTDPPSIPVVELFPSGEFPEGEIQEYKDETTSEEKR 113 > 7297553 Length=448 Score = 33.5 bits (75), Expect = 0.17, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Query 114 QTVPPTKTMQQLFPAGDFPKGEVQLYASP---PHDAEAR 149 QT PPT + +L+P G+FP+GE+ + +P P D A+ Sbjct 79 QTDPPTIPIAKLYPDGNFPEGEIVEHPTPKDMPDDRTAK 117 > Hs9910182 Length=371 Score = 30.4 bits (67), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Query 102 CLGSWPERKPSQQTVPPTKTMQQLFPAGDFPKGEVQLYASPP 143 C WP+R P ++T K Q+FP+G P + SPP Sbjct 287 CCSGWPQRHPKRKTQKHLKRKSQMFPSG--PVSSCRRVHSPP 326 > SPBC14C8.03 Length=426 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 111 PSQQTVPPTKTMQQLFPAGDFPKGEVQLYA 140 P +QT PPT + ++F +P GEV YA Sbjct 62 PQEQTNPPTVGLSKIFVNKKYPVGEVCDYA 91 > Hs4757758 Length=140 Score = 27.7 bits (60), Expect = 9.2, Method: Compositional matrix adjust. Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%) Query 54 AAAAAGGQGAAAAAKKKKKKKKKSAAAAAAAAAKTLGFEPAQDNSALRCLGSWPERKPSQ 113 + AAGG+G + + + S+AA + + G + + L+ +G P K + Sbjct 13 TSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKK 72 Query 114 QTVPPTKTMQQLFPAGDFPKGEVQLYAS 141 V T+T+Q L DF K ++L AS Sbjct 73 WAVERTRTIQGLI---DFIKKFLKLVAS 97 Lambda K H 0.304 0.120 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1858150626 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40