bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1537_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value SPAC222.14c 41.6 3e-04 At5g45160 31.6 0.39 YOR165w 28.9 2.5 At2g25090 28.1 3.9 At1g61580 27.7 5.9 SPCC1450.10c 26.9 9.4 7291891 26.9 9.8 > SPAC222.14c Length=762 Score = 41.6 bits (96), Expect = 3e-04, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 0/49 (0%) Query 44 MVTLSGGDLVQVIDYDGEMTADLEKWMRDQGLADVGFSFNVITILGSQS 92 M T S Q++D + +L K+M+ GL D GF+++V+ +LGSQS Sbjct 1 MSTASNRVSTQIVDEHKQFNNELPKFMQSVGLLDAGFNYHVVAVLGSQS 49 > At5g45160 Length=834 Score = 31.6 bits (70), Expect = 0.39, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query 54 QVIDYDGEMTAD-LEKWMRDQGLADVGFSFNVITILGSQS 92 Q+ID +GE L+ +++ L+D G S+ V+ I+G QS Sbjct 11 QLIDGNGEFNVKGLDNFVKKTKLSDCGLSYAVVAIMGPQS 50 > YOR165w Length=776 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query 53 VQVIDYDGEM-TADLEKWMRDQGLADVGFSFNVITILGSQS 92 +Q+ID + E + L+ + + G DVG ++VI++ GSQS Sbjct 7 IQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQS 47 > At2g25090 Length=469 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 0/37 (0%) Query 44 MVTLSGGDLVQVIDYDGEMTADLEKWMRDQGLADVGF 80 M ++GG+L ++ID DG++ DL + Q ++ V F Sbjct 93 MEYVNGGELFEMIDRDGKLPEDLARKYFQQLISAVDF 129 > At1g61580 Length=390 Score = 27.7 bits (60), Expect = 5.9, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 25/40 (62%), Gaps = 0/40 (0%) Query 19 AIVLAVVHLRREQQQQLRRKQQRVKMVTLSGGDLVQVIDY 58 +++ + H + + + L++K+ + + ++GGD+ + +DY Sbjct 158 SVIRVLAHTQIRKMKGLKQKKAHLNEIQINGGDIAKKVDY 197 > SPCC1450.10c Length=538 Score = 26.9 bits (58), Expect = 9.4, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query 11 CSGCPTVAAIVLAVVHLRREQQQQLR-RKQQRVKMVTLS 48 CSGC T A VL + +E + L RK Q + V+LS Sbjct 67 CSGCITSAETVLVNLQSYQEVLKHLESRKSQEILYVSLS 105 > 7291891 Length=589 Score = 26.9 bits (58), Expect = 9.8, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 16 TVAAIVLAVVHLRREQQQQLRRKQQRVKMVTLSGGDLVQVIDY 58 + + IV V +L ++QQL+ + ++ L+GG+ V V+ + Sbjct 529 SFSLIVAGVYYLNSRREQQLQESKTSAELEALNGGENVIVVHH 571 Lambda K H 0.321 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171209254 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40