bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1025_orf1 Length=61 Score E Sequences producing significant alignments: (Bits) Value 7304131 42.4 2e-04 Hs15321446 40.4 8e-04 At1g51980 35.0 0.034 Hs20535969 33.5 0.11 At3g16480 33.1 0.14 CE27028 31.6 0.41 SPCC613.10 29.6 1.4 > 7304131 Length=556 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 0/41 (0%) Query 18 ATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRAAG 58 A DI+RVA+++ S PP+V A GDI ++P I A+ +G Sbjct 504 AADIQRVAQRLLSSPPSVAARGDIHNLPEMSHITNAVSGSG 544 > Hs15321446 Length=525 Score = 40.4 bits (93), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 0/46 (0%) Query 11 TLWLKLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALRA 56 TL + D++RVA KM P V A GD+ +P YE I+ AL + Sbjct 467 TLIRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSS 512 > At1g51980 Length=503 Score = 35.0 bits (79), Expect = 0.034, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 0/41 (0%) Query 15 KLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALR 55 +L DI K+ SKP T+ ++GD+ +VP Y+ I + R Sbjct 463 QLTLKDIADFTSKVISKPLTMGSFGDVLAVPSYDTISSKFR 503 > Hs20535969 Length=417 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 20 DIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAAL 54 D++RVA K+ P V A G +P Y+ I+ AL Sbjct 368 DVKRVASKILQGKPVVAALGKSTDLPAYKHIQTAL 402 > At3g16480 Length=448 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 15 KLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEIRAALR 55 +L DI K+ +KP T+ +GD+ +VP Y+ + R Sbjct 408 QLTLKDIADFTSKVITKPLTMATFGDVLNVPSYDSVSKRFR 448 > CE27028 Length=477 Score = 31.6 bits (70), Expect = 0.41, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 15 KLFATDIRRVAEKMFSKPPTVVAYGDI 41 K+ +DI RV E++ + P++V YGDI Sbjct 428 KVTNSDIIRVTERLLASKPSLVGYGDI 454 > SPCC613.10 Length=426 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 15 KLFATDIRRVAEKMFSKPPTVVAYGDICSVPHYEEI 50 K+ I +V + +KP + VA G++ +P+Y+E+ Sbjct 391 KVTPASISKVVSSLLAKPASTVAVGNLDVLPYYDEL 426 Lambda K H 0.323 0.134 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178852562 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40