bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0410_orf5 Length=193 Score E Sequences producing significant alignments: (Bits) Value At2g19270 40.0 0.003 Hs20070218 39.3 0.004 CE20559 37.7 0.013 7292125 37.4 0.020 At3g10170 29.3 4.7 At1g55250 28.5 9.0 > At2g19270 Length=359 Score = 40.0 bits (92), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 152 MQKRKHQINWLAAEAHDKEMELLELTARTRQTKYQTAMKYGW 193 + KRKHQI L + KE EL E +R TK +T KYGW Sbjct 318 LHKRKHQITALFMDMKHKESELTERRSRGLLTKAETQAKYGW 359 > Hs20070218 Length=491 Score = 39.3 bits (90), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 0/46 (0%) Query 148 EPKVMQKRKHQINWLAAEAHDKEMELLELTARTRQTKYQTAMKYGW 193 +P Q+RKHQI +L +A ++E+EL + + ++ QT KYG+ Sbjct 446 QPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYGF 491 > CE20559 Length=405 Score = 37.7 bits (86), Expect = 0.013, Method: Compositional matrix adjust. Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 29/180 (16%) Query 26 TAEATAEAAAAAAADEAAAERAAAEAAAAEEAA---AAASRYWEYREEDAAVEELGIEKT 82 T ++ + + DE R E EE +AS W +R+ + + K Sbjct 243 TMNSSMDVVGPSRPDEGMDPRQMYEMPEEEEDVQEGPSASNAWLHRK----INDEQAHKL 298 Query 83 LLEKS-GISTAELRDLRRMGATSVLGATLQNPDWHLTAQAGPQKKAKLRLATKVWSAKDR 141 L+ S I E R + M A S++ D ++ GP K + + + R Sbjct 299 LMRFSHDIGQEERRSINEM-ANSIV-------DVNVDDALGPDVKTNI-----IKNLGHR 345 Query 142 AITETLE---PKV-----MQKRKHQINWLAAEAHDKEMELLELTARTRQTKYQTAMKYGW 193 A E P+V M +RKHQI +LA+ A +E +L + A +Q+K KYG+ Sbjct 346 AFVEATSAPLPQVQTQGQMSRRKHQITYLASLAVSREEQLKDQWADQKQSKRMARQKYGF 405 > 7292125 Length=472 Score = 37.4 bits (85), Expect = 0.020, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 0/46 (0%) Query 148 EPKVMQKRKHQINWLAAEAHDKEMELLELTARTRQTKYQTAMKYGW 193 EP +RKHQI +LA +A E EL + + RQT+ T KYG+ Sbjct 427 EPVAGTRRKHQITYLAHKAKANEAELQAMWSANRQTRRATQSKYGF 472 > At3g10170 Length=634 Score = 29.3 bits (64), Expect = 4.7, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 135 VWSAKDRAITETLEPKVMQKRKHQINWLAAEAHDKEMEL 173 +WS+K++A+TE +E K+ + QI L+ E +++ EL Sbjct 411 IWSSKEKALTEAVEEKIRLYKNIQIESLSKEMSEEKKEL 449 > At1g55250 Length=899 Score = 28.5 bits (62), Expect = 9.0, Method: Compositional matrix adjust. Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Query 110 LQNPDWHLTAQAGPQKKAKLRLATKVWSAKDRAITETLEPKVMQKRKHQI-----NWLAA 164 +Q + HL Q + ++L ++ K T E +VM+K+ HQ+ N+ A Sbjct 669 MQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKAR 728 Query 165 EAHDKE 170 AH++E Sbjct 729 IAHNEE 734 Lambda K H 0.305 0.115 0.315 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3228275340 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40