bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0347_orf3 Length=55 Score E Sequences producing significant alignments: (Bits) Value HsMi004 79.7 1e-15 Hs22053514 71.6 3e-13 DmMi004 71.6 3e-13 AtMi014 63.2 1e-10 CEMi003 62.4 2e-10 SPMi010 62.0 2e-10 Hs20541261 58.9 2e-09 YMi025 53.1 1e-07 Hs17482743 51.6 4e-07 Hs22045066 42.7 2e-04 > HsMi004 Length=227 Score = 79.7 bits (195), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 +YEYTDY L F+SY++P L+PG+LRLL+VDNRVVLPIE IRM+++S+DVLH Sbjct 107 TYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLH 161 > Hs22053514 Length=98 Score = 71.6 bits (174), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 33/40 (82%), Positives = 38/40 (95%), Gaps = 0/40 (0%) Query 5 TDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITI 44 +DYEDL FDSYIIPT++LKPGELRLL+VDNRV+LPIEI I Sbjct 57 SDYEDLGFDSYIIPTTDLKPGELRLLKVDNRVILPIEIPI 96 > DmMi004 Length=228 Score = 71.6 bits (174), Expect = 3e-13, Method: Composition-based stats. Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYEY+D+ ++ FDSY+IPT+EL RLL+VDNRVVLP+ IR+LV++ DV+H Sbjct 107 SYEYSDFNNIEFDSYMIPTNELMTDGFRLLDVDNRVVLPMNSQIRILVTAADVIH 161 > AtMi014 Length=260 Score = 63.2 bits (152), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 31/60 (51%), Positives = 45/60 (75%), Gaps = 5/60 (8%) Query 1 SYEYTDY-----EDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 +YEY+DY + L+FDSY+IP +L+ G+ RLLEVDNRVV+P + +R++V+S DV H Sbjct 128 TYEYSDYNSSDEQSLTFDSYMIPEEDLELGQSRLLEVDNRVVVPAKTHLRIIVTSADVPH 187 > CEMi003 Length=231 Score = 62.4 bits (150), Expect = 2e-10, Method: Composition-based stats. Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 0/55 (0%) Query 1 SYEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYEY+D L FDSY+ +L GE RLLEVDNR V+P + IR ++S DV+H Sbjct 110 SYEYSDIPGLEFDSYMKSLDQLSLGEPRLLEVDNRCVIPCDTNIRFCITSADVIH 164 > SPMi010 Length=248 Score = 62.0 bits (149), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 31/60 (51%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Query 1 SYEYTDY-----EDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 SYE D+ E +SFDSY++P +L+ G LR LEVDNR+VLPI+ IR++++S DV+H Sbjct 123 SYELNDFVTNENEPVSFDSYMVPEEDLEEGSLRQLEVDNRLVLPIDTRIRLILTSGDVIH 182 > Hs20541261 Length=164 Score = 58.9 bits (141), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%) Query 2 YEYTDYEDLSFDSYIIPTSELKPGELRLLEVDNRVV 37 YEYTDYED+SFDSY+ PT++LKPGELRLLE VV Sbjct 109 YEYTDYEDVSFDSYMTPTTDLKPGELRLLEAGLPVV 144 > YMi025 Length=251 Score = 53.1 bits (126), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 41/60 (68%), Gaps = 5/60 (8%) Query 1 SYEYTDY-----EDLSFDSYIIPTSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVLH 55 YEY+D+ E + F+SY+IP L+ G+LRLL+ D +V+P++ IR +V++ DV+H Sbjct 127 KYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIH 186 > Hs17482743 Length=194 Score = 51.6 bits (122), Expect = 4e-07, Method: Composition-based stats. Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%) Query 19 TSELKPGELRLLEVDNRVVLPIEITIRMLVSSEDVL 54 TS+LKPGEL+LLE DN+V P+E +I++L SS+D+L Sbjct 53 TSDLKPGELQLLEFDNQVAFPVETSIQILSSSKDIL 88 > Hs22045066 Length=300 Score = 42.7 bits (99), Expect = 2e-04, Method: Composition-based stats. Identities = 19/27 (70%), Positives = 25/27 (92%), Gaps = 1/27 (3%) Query 5 TDYEDLSFDSYIIPTSELKPGELRLLE 31 ++YE+L FDSY+IPT++LKP ELRLLE Sbjct 204 SNYEELGFDSYMIPTADLKP-ELRLLE 229 Lambda K H 0.317 0.139 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197145602 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40