bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0171_orf1 Length=50 Score E Sequences producing significant alignments: (Bits) Value YIL070c 38.1 0.004 SPBC776.07 37.4 0.007 At3g55600_2 37.0 0.008 At5g02050 36.6 0.011 At1g15870 32.7 0.17 At2g39790 32.0 0.26 At4g32610 31.2 0.45 At5g05990 30.4 0.84 At1g80720 29.6 1.3 CE17940 28.5 3.3 > YIL070c Length=266 Score = 38.1 bits (87), Expect = 0.004, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 0/39 (0%) Query 7 SWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 ++L + GV+ +L F+ A++ KEN EY+ WL K+ F Sbjct 227 AYLESRGVNEELASFISAYSEFKENNEYISWLEKMKKFF 265 > SPBC776.07 Length=269 Score = 37.4 bits (85), Expect = 0.007, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 HS+L +D L F+ +F KE +EY+ WL V FL Sbjct 229 HSYLEERKIDESLSSFIVSFGLTKELKEYINWLESVRQFL 268 > At3g55600_2 Length=248 Score = 37.0 bits (84), Expect = 0.008, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 H +L G+ DFL + K++REYL WL K+ F+ Sbjct 207 HKFLETRGIKASATDFLYEYMMKKDSREYLLWLKKLKTFV 246 > At5g02050 Length=267 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 H +L G+ FL + A+K++REYL+WL + +F+ Sbjct 226 HRYLEIRGIKPSFTTFLADYVANKDSREYLQWLKDLKSFV 265 > At1g15870 Length=190 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 + +L G+ L +FL + +K+ EY+RW+ V +++ Sbjct 148 YRFLEERGISDDLAEFLHQYMKNKDKAEYIRWMETVKSYV 187 > At2g39790 Length=429 Score = 32.0 bits (71), Expect = 0.26, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 + +L GV +FL + K NREY WL V F+ Sbjct 388 YKFLEIRGVKASTTNFLHEYMTRKVNREYFLWLKNVKEFM 427 > At4g32610 Length=557 Score = 31.2 bits (69), Expect = 0.45, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL-ANP 48 H +L GV+ L FL+A+ K++R LRW V F+ NP Sbjct 508 HGFLEERGVNESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENP 551 > At5g05990 Length=259 Score = 30.4 bits (67), Expect = 0.84, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 H ++ G+ + +FL + +K++RE+L WL + F+ Sbjct 218 HRYIEIRGIKPSMINFLHEYMINKDSREHLLWLKSLKNFV 257 > At1g80720 Length=190 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 6 HSWLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFL 45 + +L G+ +L FL + +K EY+RW+ V +++ Sbjct 148 YQFLEERGISDELAVFLHRYMKNKGKAEYVRWMESVKSYV 187 > CE17940 Length=236 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 8 WLAAVGVDGQLCDFLEAFAADKENREYLRWLHKVHAFLA 46 +L G+D + C L A+A E+ +Y+ L K+ F++ Sbjct 197 YLEERGLDARFCKTLVAYATHYEHSQYVGLLDKIKKFIS 235 Lambda K H 0.323 0.137 0.462 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164550556 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40