bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0100_orf2 Length=145 Score E Sequences producing significant alignments: (Bits) Value At2g44580_1 32.0 0.41 CE18037 30.8 0.91 7302400 30.4 1.3 YPR125w 29.3 2.4 Hs13129096 29.3 2.4 CE18230 28.9 3.9 Hs22047498 27.3 9.5 > At2g44580_1 Length=359 Score = 32.0 bits (71), Expect = 0.41, Method: Compositional matrix adjust. Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Query 16 SSTRQFAALLPDA-EERRAFVQGMLLSPLRGFFIAVEGQLLMLPAAELPLTLRERLVAAF 74 S ++ +PD EER ++G +L+ I +E ++ LP T ER F Sbjct 289 SFMEEWKKKIPDGMEERFEMLEGEVLTEK----IGIETRVYTFSVRSLPSTPEERFSVLF 344 Query 75 ATKTVWREEELQPFL 89 ++ W ++L+P+L Sbjct 345 KHRSKWEWKDLEPYL 359 > CE18037 Length=517 Score = 30.8 bits (68), Expect = 0.91, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 57 LPAAELPLTLRERLVAAFATKTVWREEELQPFL 89 L +LP T++ER++ F + +W E+L+P+ Sbjct 451 LSPEDLPDTIKERMLYLFEYRKLWSMEQLRPYF 483 > 7302400 Length=393 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 62 LPLTLRERLVAAFATKTVWREEELQPFL 89 LP + +R+ A F TK W EE++P++ Sbjct 365 LPTNISDRMRALFKTKKRWTMEEMEPYI 392 > YPR125w Length=454 Score = 29.3 bits (64), Expect = 2.4, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 0/49 (0%) Query 41 SPLRGFFIAVEGQLLMLPAAELPLTLRERLVAAFATKTVWREEELQPFL 89 S L G I + +LLM AA PLT RE L T+ + R FL Sbjct 96 SKLLGLEIKISSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFL 144 > Hs13129096 Length=393 Score = 29.3 bits (64), Expect = 2.4, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query 54 LLMLPAAELPLTLRERLVAAFATKTVWREEELQPFL-SLC 92 + +L +LP +ER + F+ + W EE++ P++ LC Sbjct 322 IFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDLC 361 > CE18230 Length=490 Score = 28.9 bits (63), Expect = 3.9, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%) Query 12 SGGSSSTRQFAALLPDAEERRAFVQGMLLSPLRGFFI 48 S GSSSTR L PDAE R ++S L+ F+ Sbjct 190 SDGSSSTRGNPQLDPDAERRDDEEMDKIISDLKHLFV 226 > Hs22047498 Length=335 Score = 27.3 bits (59), Expect = 9.5, Method: Compositional matrix adjust. Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 0/65 (0%) Query 3 AAASVASAXSGGSSSTRQFAALLPDAEERRAFVQGMLLSPLRGFFIAVEGQLLMLPAAEL 62 AS A SG + S F+ L +A+E FV G +L G F+A++ +L + + Sbjct 159 GGASGADTNSGVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLALQRNTTVLNSKVI 218 Query 63 PLTLR 67 +T++ Sbjct 219 SVTVK 223 Lambda K H 0.319 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1712413322 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40