bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8221_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_3660 71.6 6e-12 > 5807.cgd1_3660 Length=205 Score = 71.6 bits (174), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 1/79 (1%) Query 15 MPGAHG-QGCGCKPENEFNLGEFLFGYIDVDGVRGINEQETGSARRTIRPYDERLNDSVS 73 MPG HG GC C+ E G+ L I++D V +NE GS R RPY++RL++ Sbjct 1 MPGEHGGAGCSCQHEAVITSGKDLLSEIELDKVMALNELNVGSCRGIFRPYEDRLSEDKV 60 Query 74 CKSEEGDAELIIYIPFISP 92 CKS++ D ELII++ F SP Sbjct 61 CKSQDDDPELIIFVRFSSP 79 Lambda K H 0.314 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22844715270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40