bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8095_orf1 Length=73 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0038 91.3 7e-18 > 5833.PF08_0038 Length=568 Score = 91.3 bits (225), Expect = 7e-18, Method: Composition-based stats. Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 2/73 (2%) Query 1 GFGSRLLLPVNSFEAWEGEQQQPTEYIEVPSEVFGQPLRPDILHQVYWHIRRSLAGWSER 60 GF S+L +P+ FEA E + +YI VP+++FG P+R DILH+ Y+ R +LAG++ER Sbjct 168 GFNSKLEIPIYKFEADENDDN--IKYISVPNDIFGLPIRSDILHKCYYFYRTALAGYTER 225 Query 61 LQLYKWEWPGSSK 73 +QLYKWEWPGS+K Sbjct 226 MQLYKWEWPGSTK 238 Lambda K H 0.318 0.137 0.465 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22503773628 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40