bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7774_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 195103.CPF_2735 129 4e-29 > 195103.CPF_2735 Length=245 Score = 129 bits (323), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 62/88 (70%), Positives = 68/88 (77%), Gaps = 1/88 (1%) Query 9 EDARYVLANATETKILATFNARSLLNFFSLRCCNRAQWEIRQMAYLMLAEVKKVAPLLFK 68 EDARYV NA ETKI+ T NARSL+NFF RCC+RAQWEIR MA M+ EVKKVAP+LFK Sbjct 155 EDARYVFPNACETKIVFTMNARSLMNFFHHRCCDRAQWEIRTMAEKMVNEVKKVAPILFK 214 Query 69 NAGATCVRTGRCPEGAMTCGKFKEMLKL 96 NAG +CV G CPEG M CGK KEM L Sbjct 215 NAGPSCV-AGPCPEGKMCCGKLKEMRTL 241 Lambda K H 0.325 0.134 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23144316443 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40