bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7764_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000003536 75.9 4e-13 > 7719.ENSCINP00000003536 Length=249 Score = 75.9 bits (185), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 38/84 (45%), Positives = 51/84 (60%), Gaps = 2/84 (2%) Query 15 ALKMTRYASLDHWEERYKKDPEPFDWFNKYAALKPFLLSAGLEESHEILMLGCGTSTMSE 74 A K T+Y ++W+ERY+ + E +DWF Y K +L + ILMLGCG S SE Sbjct 2 AKKNTQYKEKEYWDERYETE-ESYDWFKGYDDFKS-VLKNHMNTQDRILMLGCGNSPFSE 59 Query 75 SLWDDGFRNITNIDFSSQCINIMQ 98 L+ DG+RNI NID+S CI M+ Sbjct 60 HLYKDGYRNIVNIDYSHICIEKME 83 Lambda K H 0.323 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23144316443 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40