bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7540_orf1 Length=83 Score E Sequences producing significant alignments: (Bits) Value 342610.Patl_1544 70.9 1e-11 > 342610.Patl_1544 Length=349 Score = 70.9 bits (172), Expect = 1e-11, Method: Composition-based stats. Identities = 32/73 (43%), Positives = 49/73 (67%), Gaps = 0/73 (0%) Query 9 GVAVVAATQCHKGTANLLIYENGIWISSLGVICAKDMTPEAVVAKLYYLMGKGVTGRRLK 68 G+ +V TQC +G N+ Y NG + +GV+ DMTPEA +AKL+YL+ K ++ +K Sbjct 277 GILIVNCTQCLRGKVNMSGYANGNVLQDVGVLSGGDMTPEAALAKLHYLLSKTLSVSEMK 336 Query 69 ELMESNLRGEVTV 81 + + SNL+GE+TV Sbjct 337 QRLTSNLKGELTV 349 Lambda K H 0.319 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22659344793 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40