bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7494_orf1 Length=90 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000021484 65.1 5e-10 > 69293.ENSGACP00000021484 Length=283 Score = 65.1 bits (157), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 4/65 (6%) Query 3 LAVCQPNWGSLKCSDSTGDLYVDQYECRGADQAAIKEARLSFFSAHSSNSSCAMLYTIIY 62 LAVC+P+WG + CS YV+ + C G D + EARLSF+S HSS S ML+ +Y Sbjct 130 LAVCKPDWGKINCSSGA---YVEDFACTG-DPDVVNEARLSFYSGHSSFSMYCMLFLALY 185 Query 63 LQCRL 67 LQ RL Sbjct 186 LQARL 190 Lambda K H 0.320 0.127 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22993711830 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40