bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6940_orf1 Length=98 Score E Sequences producing significant alignments: (Bits) Value 10090.ENSMUSP00000023465 118 5e-26 > 10090.ENSMUSP00000023465 Length=862 Score = 118 bits (296), Expect = 5e-26, Method: Composition-based stats. Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%) Query 1 DLGICLVHGLMAIDAELVLPFVRASIEQLVDVIAKGKAPREAVVQHSLKIFKAKFCYFVN 60 +LGI LVHG IDAELVLP +R+++E+ +++IA+GKA V+ H+L IFK KF YFV+ Sbjct 539 NLGIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYHQVLGHTLDIFKRKFHYFVD 598 Query 61 KVERMDALFDVTFTALSATGNPLSRCGRCNRYMNFI 96 + MD L +V+F+ L+ATG PLSRCG+C+R+M +I Sbjct 599 SIAGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYI 634 Lambda K H 0.330 0.141 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22397725590 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40