bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6757_orf2 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0053 96.7 2e-19 > 5833.PF11_0053 Length=1426 Score = 96.7 bits (239), Expect = 2e-19, Method: Composition-based stats. Identities = 47/118 (39%), Positives = 81/118 (68%), Gaps = 1/118 (0%) Query 5 EMKLQKEQLLSEGFLNWNRTEFTKFVSGLIQFGRDRLEEAWQMHFSNSNKTVEDLRKYAA 64 ++KLQK++L+ +GF WN+ EF K +SGLI +G + +E ++ +FSNS K++ED++ Y Sbjct 1195 KIKLQKQELMKQGFAKWNKAEFNKLMSGLIIYGTNEVEYIYEKYFSNSKKSMEDIKAYLT 1254 Query 65 VFFQRYSEIEGGDRMMQRIERAEELRGALDLQRRAIQATVEEQLLSGTVSSPQCLRLP 122 VFF++Y +I+GG R+ +I+R++ + ++ + I VE+QL G V S + L+LP Sbjct 1255 VFFRKYDQIKGGVRLFDKIKRSDLQKKIIEEENDMITEFVEKQLSEG-VDSIEKLQLP 1311 Lambda K H 0.320 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40