bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6741_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value 4896.SPAC17A5.15c 119 4e-26 > 4896.SPAC17A5.15c Length=716 Score = 119 bits (297), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 57/125 (45%), Positives = 74/125 (59%), Gaps = 0/125 (0%) Query 1 EWDKLWTLNRQVIDPIVPRFMAVSRTDGVKVTISGAPENVATQPRRLHAKNEALGQVPLY 60 +W W N+++IDP+ PR AV D VK TI P + R H KN LG Sbjct 497 DWTSFWATNKKIIDPVAPRHTAVESGDVVKATIVNGPAAPYAEDRPRHKKNPELGNKKSI 556 Query 61 LHNTILIETDDAQLCQDGEEVTLMHWGNCVFERLERDSTGKVTAISAKLHLEGDFKKTKK 120 N ILIE DAQ + EEVTLM WGN + RD++GKVT++ +LHL+GDFKKT+K Sbjct 557 FANEILIEQADAQSFKQDEEVTLMDWGNAYVREINRDASGKVTSLKLELHLDGDFKKTEK 616 Query 121 KLNWV 125 K+ W+ Sbjct 617 KVTWL 621 Lambda K H 0.318 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22670743557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40