bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6726_orf2 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_1410 152 2e-36 > 5807.cgd6_1410 Length=1005 Score = 152 bits (385), Expect = 2e-36, Method: Composition-based stats. Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 1/152 (0%) Query 2 KLMSDYDKWEAQQLQRSGLVSSKENPY-YDEEAGGILPAQEAEEDVEIEVVDEEPLFIRG 60 ++ +DY+KWE QL SG++S E PY + G + Q E EIE+ + EPLF+RG Sbjct 176 RVSNDYEKWEIMQLLNSGVISRDEIPYDICDTTGDTIDFQNVEISTEIELRNYEPLFLRG 235 Query 61 QTTRAGMQLSPVKIVANPDGSLARAAATAQTLAKERRDVRQAQEAAILDSIPKDMSRPWE 120 Q+ + S +++V NP+GSL +AA A +A+ERR++R QE ++DSIP+DM+RPWE Sbjct 236 QSIKKFNFDSSIQVVVNPEGSLNKAAELASNIARERREIRDFQEKTLIDSIPRDMNRPWE 295 Query 121 DPNPQPGERTIAQALQGLGQTGYEMPEWKRLY 152 DPNP+ GERTIA AL+G+G PEWKR Y Sbjct 296 DPNPEAGERTIASALRGIGMNSQTTPEWKRQY 327 Lambda K H 0.310 0.129 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40