bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6641_orf3 Length=106 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000013105 96.7 2e-19 > 7955.ENSDARP00000013105 Length=2337 Score = 96.7 bits (239), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 4/106 (3%) Query 1 SYECECKDGYGHMEGNACSDIDECATAAHTCDPNATCVNTVGSFECGCKEGFSGDGHTCT 60 S++C C+DG+ +G C D+DEC T H C+PNA C+NT GS+ C CKEGF+GDG +C+ Sbjct 815 SFKCRCRDGW-EGDGIKCIDVDECVTEEHNCNPNAECLNTPGSYRCSCKEGFNGDGFSCS 873 Query 61 DIDECADPNLNKCDTHKGICQNGTGSYTCGCRPGYSLAADGFTCDN 106 D+DECAD N+N C+ G C N G Y C C G++ D C + Sbjct 874 DMDECAD-NVNLCE--NGQCLNAPGGYRCECEMGFTPTEDSKACQD 916 Lambda K H 0.318 0.136 0.478 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22605445551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40