bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6593_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value 5207.CNA06170 62.4 4e-09 > 5207.CNA06170 Length=398 Score = 62.4 bits (150), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 29/51 (56%), Positives = 33/51 (64%), Gaps = 0/51 (0%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 Q H L S LDA+G TPL+ L R+ G C LLGKCEF SAGGS+KD Sbjct 9 QHHWHGVLSSALDAVGHTPLIRLDRIAAEEGFKCNLLGKCEFFSAGGSVKD 59 Lambda K H 0.318 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40