bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6560_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0231973 62.4 4e-09 > 44689.DDB_0231973 Length=2473 Score = 62.4 bits (150), Expect = 4e-09, Method: Composition-based stats. Identities = 33/116 (28%), Positives = 61/116 (52%), Gaps = 1/116 (0%) Query 4 FFELVQECHREGMKVVVDVSTRVSASHPHRHYLPLMLLHEDAEGKANYLYGGETRGIRRG 63 F +LV + G+K+V+D +TR+S+ HR Y ++ D G+ + L G ++ Sbjct 1389 FSQLVNRAKQLGIKIVIDSTTRLSSKAAHRKYKGVVCHTLDNNGQLSRLEGTDSSEFTWN 1448 Query 64 ETALLNYRKVASWNRFVLDVLAWIKKFGIDGVKLLDSATAPEVLLPNSRALSRRDA 119 + +N RK++ W FV + L W + G+DG+++ + T P + N + R D+ Sbjct 1449 DCVSMNMRKLSVWEMFVQETLLWGDR-GVDGIRIDSAHTCPLLFRSNLDEMYRLDS 1503 Lambda K H 0.321 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40