bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6496_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 31033.SINFRUP00000161465 71.6 7e-12 > 31033.SINFRUP00000161465 Length=2952 Score = 71.6 bits (174), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 40/109 (36%), Positives = 62/109 (56%), Gaps = 2/109 (1%) Query 13 DVMLVVDESGSIGTSNFRKVRQFIEDFVNSMPISPEDVRVGLITFATRSKVRWNLSDPKA 72 DV+L+VD S SIG +NF KVR F+E VN+ I P+ V++ L+ ++ + L+ Sbjct 416 DVVLLVDGSYSIGLANFAKVRAFLEVLVNTFDIGPDKVQISLVQYSRDPHTEFYLN--TH 473 Query 73 TNPSLAISAARSLSYSTGVTYTHYGLQDAKKLLYDTNAGARNNVPKLVL 121 N I+A R+ Y G T T + +K ++ TN GAR NVP++ + Sbjct 474 NNLEAVITALRTFPYRGGSTNTGKAMTYVRKTVFQTNRGARANVPRVTI 522 Lambda K H 0.317 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40