bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6304_orf1 Length=84 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0238 83.2 2e-15 > 5833.PF13_0238 Length=726 Score = 83.2 bits (204), Expect = 2e-15, Method: Composition-based stats. Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 0/73 (0%) Query 1 NIDYKALCDVEVYDALLSLWLPGSPLLIPRRNACAANLEKRIFVIGGFDGNSILASVECI 60 N DYKAL + EVYD L +W S L IPRRN C RI+ IGG+DG+SI+ +VE Sbjct 499 NYDYKALFETEVYDRLRDVWYVSSNLNIPRRNNCGVTSNGRIYCIGGYDGSSIIPNVEAY 558 Query 61 DTRIKHWMHAAPL 73 D R+K W+ APL Sbjct 559 DHRMKAWVEVAPL 571 Lambda K H 0.326 0.142 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22587329789 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40