bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6270_orf2 Length=68 Score E Sequences producing significant alignments: (Bits) Value 411154.GFO_0313 72.8 3e-12 > 411154.GFO_0313 Length=454 Score = 72.8 bits (177), Expect = 3e-12, Method: Composition-based stats. Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 0/65 (0%) Query 3 AGGLGTTAKRTEGGYILNGRKRRIGNATICDVAVVWARDLDTGKIEGFLVEKSFRGFKTA 62 AGGL TT K ++LNG+K+ IGNAT DV ++WARDLD+ +++GFLV K GFK Sbjct 207 AGGLETTCKFDGENWVLNGQKKWIGNATFADVTIIWARDLDSNQVKGFLVRKENPGFKAE 266 Query 63 AIKEK 67 IK K Sbjct 267 KIKGK 271 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851432268 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40