bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6179_orf1 Length=150 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000025065 175 4e-43 > 8090.ENSORLP00000025065 Length=682 Score = 175 bits (443), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 82/137 (59%), Positives = 110/137 (80%), Gaps = 1/137 (0%) Query 1 RDADGHYWITGRVDDTLNVSGHRLSTAEIEHALVQHPHIVEAAVVGTPHDVKGTAIFCFV 60 RD DG+YWITGR+DD LNVSGH LSTAE+E ALV+H + EAAVVG PH +KG +++CFV Sbjct 537 RDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHRAVAEAAVVGRPHPIKGESLYCFV 596 Query 61 ILKAGTSPAGIIE-EAKMQVRKEIGPIATPDFIVVAPGLPKTQSGKIMRRLLRKLCCLDT 119 LK G + + ++E E K QVR++IG IATPD+I APGLPKT+SGKIMRR+LRK+ C + Sbjct 597 TLKDGVAYSQMLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNEK 656 Query 120 NLGDTTSLSNADIVQTL 136 +LGD ++L+++ +V+ L Sbjct 657 DLGDISTLADSSVVEEL 673 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40