bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6173_orf1 Length=104 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G34280.1 92.0 4e-18 > 3702.AT4G34280.1 Length=783 Score = 92.0 bits (227), Expect = 4e-18, Method: Composition-based stats. Identities = 44/104 (42%), Positives = 63/104 (60%), Gaps = 2/104 (1%) Query 1 SVSVNSTDDYLLVSGRSPDLTIHDVATGARLGALRNLHSDSINIVRFAHTSPHLFVTASF 60 SV NSTD L SG S D+ ++D+ G RL N+H + IN+V+F++ SP LF T+SF Sbjct 545 SVHANSTDQLFLASGYSKDVALYDIGRGTRLQVFANMHQEHINVVKFSNHSPFLFATSSF 604 Query 61 DQACRLWDLRQRINGHQPLLTVDTGSLSVMCCFDDSDEWLFVAA 104 D+ +LWDLRQ + +P T + +VM CF D +L +A Sbjct 605 DKDVKLWDLRQEPS--RPCYTASSTKGNVMVCFSPDDRYLLASA 646 Lambda K H 0.323 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22759408663 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40