bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6077_orf3 Length=134 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_1G09280 133 1e-30 > 5085.AFUA_1G09280 Length=429 Score = 133 bits (335), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 66/132 (50%), Positives = 94/132 (71%), Gaps = 6/132 (4%) Query 3 ERARIAAAGGAVANGRVDGNLNLSRSLGDLFYKKDKSIPPEKQKITAFPDVRVTPVCKED 62 E+ARI+AAGG V GRV+GNL LSR++GD +KK + PE+Q +TA+PDV V V +D Sbjct 166 EKARISAAGGFVDFGRVNGNLALSRAIGDFEFKKSPELSPEQQIVTAYPDVTVHEVTDDD 225 Query 63 EFLIIACDGIWDCKTNQEAVDFVRAHLAASRKEKAEALRDACEALCDACLSEDPIKSEGH 122 EFL+IACDGIWDC+++Q V+FVR +AA ++ L CE + D CL+ + ++ G Sbjct 226 EFLVIACDGIWDCQSSQSVVEFVRRGIAAKQE-----LYRICENMMDNCLASNS-ETGGV 279 Query 123 GRDNMTVVLVGL 134 G DNMT++++GL Sbjct 280 GCDNMTMIIIGL 291 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682284714 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40