bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6048_orf1 Length=158 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1135c 92.4 3e-18 > 5833.PFI1135c Length=222 Score = 92.4 bits (228), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 44/109 (40%), Positives = 68/109 (62%), Gaps = 4/109 (3%) Query 53 HVSYPK--NITAWE-TESSLLEQRLSFLGCRTVTSVGDGNCQFRSCSFSLFGKEDEHRHV 109 H+SY K NI + E +LE RL +GC + +GDGNC FRS S +LF K+ H +V Sbjct 64 HLSYFKKNNINKPQYNEKKILEHRLWAIGCELIEVIGDGNCLFRSISRNLFHKQKYHMYV 123 Query 110 RRMAVAQMRKCRKDYEVFFDGAPLFDRYLRDMERSGTWGDELSLRAVAD 158 R+ V M +++Y ++F+ F +Y+++M ++G WGDEL ++A AD Sbjct 124 RKKCVEYMINYKEEYSIYFENNE-FQQYIKNMSKNGYWGDELCIKATAD 171 Lambda K H 0.320 0.131 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 25621323489 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40