bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5992_orf2 Length=94 Score E Sequences producing significant alignments: (Bits) Value 402612.FP2476 85.5 4e-16 > 402612.FP2476 Length=452 Score = 85.5 bits (210), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 39/94 (41%), Positives = 66/94 (70%), Gaps = 0/94 (0%) Query 1 ILENEVDEVYCSLSDVQSHQINELIAFADNNLIHVKILPNLREIASKNVKIDFYGTTLVI 60 +L +++D++YC+L ++ ++Q+ EL+ FA+ + I +K +P EI +KN+KID+Y ++ Sbjct 187 VLYHKIDDIYCALEELSNNQLRELVEFAEYHKITIKFIPESSEIYAKNLKIDYYEFFPIL 246 Query 61 SFREIPLEDVLNKYTRRAFDIIFSLLVIAGILSW 94 S + I L L K+ +R FDI+FSLLVI +LSW Sbjct 247 SLKRIALNQPLLKFVKRLFDILFSLLVITFLLSW 280 Lambda K H 0.324 0.141 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40