bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5951_orf1 Length=127 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP011849-PA 81.3 8e-15 > 7165.AGAP011849-PA Length=398 Score = 81.3 bits (199), Expect = 8e-15, Method: Composition-based stats. Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%) Query 3 VTCCVFHPLLPQLLIGADDGNVRVISVEGSGTGTITRTFRAHHASVTGLAFDPSGRWLVT 62 VT VFHP+ ++ ++D ++V E TG RT + H SV LAFD G+ L + Sbjct 98 VTRVVFHPVFSMMVSASEDATIKVWDFE---TGEYERTLKGHTDSVQDLAFDSQGKLLAS 154 Query 63 CSSDMTLRLFDVQTSYTLKETLRGHDDSVSAIAFFTLRD 101 CSSD++++L+D Q +Y +T+ GHD +VS+++F D Sbjct 155 CSSDLSIKLWDFQQTYECVKTMHGHDHNVSSVSFVPAGD 193 Lambda K H 0.321 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22506847341 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40