bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5830_orf1 Length=85 Score E Sequences producing significant alignments: (Bits) Value 321327.CYA_1451 60.5 2e-08 > 321327.CYA_1451 Length=331 Score = 60.5 bits (145), Expect = 2e-08, Method: Composition-based stats. Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Query 5 SVPGMREDVLELALNLKTLSLRSGAPFARCRVRVHARGPLKLLGGHISFPSFLKCLNKEN 64 +VPG+REDV+E+ LN+K L LRS AP + R+ A+GP ++ + PS ++ +N + Sbjct 85 TVPGVREDVMEILLNMKELVLRSNAPDTQVG-RLVAQGPGEVTAEKLQLPSEVEVINPRH 143 Query 65 YICQLAAAAAVCFEFQVEWGR 85 +I LA A + EF + GR Sbjct 144 HIATLAEGAILEMEFMIGRGR 164 Lambda K H 0.326 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22515314785 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40