bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5792_orf4 Length=69 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G30775.1 79.3 3e-14 > 3702.AT3G30775.1 Length=499 Score = 79.3 bits (194), Expect = 3e-14, Method: Composition-based stats. Identities = 36/67 (53%), Positives = 46/67 (68%), Gaps = 0/67 (0%) Query 1 QLYGMGDAFSQGLSSAGFDVYKYVPFGPVEDTIPYLLRRARENTGMLGGAQNEVRYLCHE 60 QLYGM DA S GL AGF+V KY+PFGPV IPYLLRRA EN GM+ ++ + + E Sbjct 430 QLYGMSDALSFGLKRAGFNVSKYMPFGPVATAIPYLLRRAYENRGMMATGAHDRQLMRME 489 Query 61 ITRRVLG 67 + RR++ Sbjct 490 LKRRLIA 496 Lambda K H 0.323 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22781900540 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40