bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5647_orf2 Length=126 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000023045 94.7 6e-19 > 9258.ENSOANP00000023045 Length=232 Score = 94.7 bits (234), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 53/129 (41%), Positives = 77/129 (59%), Gaps = 10/129 (7%) Query 2 REKVPLELVLGERVGGAFKNLLEANGVEFIPNMEASEIITRDGKVTGVRLKSGRVLAADR 61 VP+E VLG R GGA L++ N VEFI N+ + I ++G +TGV L + R++ AD Sbjct 19 NSSVPMETVLGPRAGGAILKLMQQNKVEFIQNVAVKDYILKNGIITGVVLSNSRIVKADC 78 Query 62 VIVGIGVVPELPHISSSKQLQQGNR---GGLAVDPFLSCP-SHPTIFAAGDIASFPYVKS 117 VI G+G E+ +S+ L G R G + VDPF C ++AAGD+ +FPY S Sbjct 79 VIEGVG--SEI----NSEFLCGGQRTETGAILVDPFFKCVGCGDDVYAAGDVTAFPYFMS 132 Query 118 GEDIRVEHF 126 G++I V+H+ Sbjct 133 GDNINVQHW 141 Lambda K H 0.318 0.140 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40