bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5492_orf3 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0647 112 3e-24 > 5833.PF14_0647 Length=1656 Score = 112 bits (281), Expect = 3e-24, Method: Composition-based stats. Identities = 60/138 (43%), Positives = 77/138 (55%), Gaps = 1/138 (0%) Query 1 AWTARGLQDAFARLLPSDFVLRIMGALLFEGSMALFRFSLALVQMLEPDLMACDTIEAAE 60 AWTAR +QD F+R+LP DFVLRI G LFEG L + LAL++ LE D++ C IE E Sbjct 1372 AWTARCIQDGFSRMLPFDFVLRIYGIYLFEGQKTLCLYCLALLKFLENDILKCTNIEEVE 1431 Query 61 KVLYRCSTDPRLSINVLSTTARNLKTHIWRVLGEASTGLQSPYLMSTKIHEFLTIKPEGQ 120 +LY P L IN L+ A K + ST SPYLM+ K+ F + Sbjct 1432 NILYHICMHPYLDINELTQIAYRFKLKSKEKHLKFSTKCPSPYLMNVKLKTFYRPRLNDN 1491 Query 121 STIISSMGTWETIWRWLP 138 ST+I+S WE IW +P Sbjct 1492 STLINSF-HWENIWEKIP 1508 Lambda K H 0.323 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40