bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5489_orf2 Length=150 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0365w 67.8 8e-11 > 5833.PFI0365w Length=818 Score = 67.8 bits (164), Expect = 8e-11, Method: Composition-based stats. Identities = 41/147 (27%), Positives = 69/147 (46%), Gaps = 15/147 (10%) Query 1 DIRRSSARKLGKFIQGATKKKLVQTKEQRGIVSVVKINRSHPDYCKHTPVPESQKKKL-V 59 D+++SS +KL KFIQ +K KL++ KE R IVS+V I R H Y + P+ KKK + Sbjct 513 DVKKSSYKKLTKFIQHYSKMKLLKIKENRNIVSIVNIERQHALYKSYEPINVELKKKYDI 572 Query 60 ERAGASAAATSPTASGAVGAGGEEGTRDAPNAAGTARSGDEGPLVFEFCAPPAKCCRIFA 119 E + + ++ N T S ++G V EF P K I Sbjct 573 ENEQTNLSINE--------------NKNKINKTPTNHSTNKGAQVLEFYIPSNKTLNIIQ 618 Query 120 AVEVRTGRNVFFTAEEYRQVLVKYFEV 146 ++E + ++ +F + + + Y ++ Sbjct 619 SIENKVDKSSYFNISQLKDIFRSYIKL 645 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40