bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5471_orf2 Length=139 Score E Sequences producing significant alignments: (Bits) Value 5207.CNF03140 87.8 9e-17 > 5207.CNF03140 Length=1484 Score = 87.8 bits (216), Expect = 9e-17, Method: Composition-based stats. Identities = 41/108 (37%), Positives = 67/108 (62%), Gaps = 2/108 (1%) Query 5 HDHVTAGHRGQ-KNFAALSKHYYWPGMRAYTTAYVESCAHCRASKSINQKPAGLFQQLLI 63 HD +T+GH G+ K + +HY+WPG++ + Y++SC C +K+ +P G + L I Sbjct 1069 HDALTSGHPGRRKTIQLIRRHYWWPGLKGFVNHYIDSCDLCCRTKTRRHQPYGELKSLPI 1128 Query 64 PSRRGAHVSLDFVTDIPPTTTGHDSILVMVDSLSKMAHFVPIANLTNA 111 P + VS+D + +PP + G+++ILV+VD L+KMA F+P NA Sbjct 1129 PPYPWSSVSMDLIEQLPP-SHGYNTILVIVDRLTKMALFIPTTTSLNA 1175 Lambda K H 0.321 0.131 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40