bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5466_orf2 Length=126 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000020189 171 7e-42 > 8364.ENSXETP00000020189 Length=893 Score = 171 bits (432), Expect = 7e-42, Method: Compositional matrix adjust. Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 1/123 (0%) Query 1 LAGKEYGSGSSRDWAAKGPYLQGVKAVIAQSFERIHRSNLVGMGILPLQFLKGESAETHS 60 L GKEYGSGSSRDWAAKGP+LQG+KAV+A+S+ERIHRSNLVGMGI+PLQ+L GESAE Sbjct 769 LTGKEYGSGSSRDWAAKGPFLQGIKAVLAESYERIHRSNLVGMGIIPLQYLPGESAEALG 828 Query 61 LTGKERFTIALNNGK-LVPGSIIRVKTDCGKSFETKCRIDTDVEVEYFRNGGALHYVLRN 119 L+G+ER+TI + K L PG + +K D GKSFE R DTDVE+ Y+RNGG L+Y++R Sbjct 829 LSGQERYTIVIPEEKDLRPGMNVEIKLDTGKSFEAIMRFDTDVELTYYRNGGILNYMIRK 888 Query 120 ILN 122 + N Sbjct 889 MAN 891 Lambda K H 0.318 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40