bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5447_orf1 Length=187 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_3770 90.9 2e-17 > 5807.cgd4_3770 Length=1040 Score = 90.9 bits (224), Expect = 2e-17, Method: Composition-based stats. Identities = 41/101 (40%), Positives = 71/101 (70%), Gaps = 0/101 (0%) Query 6 EEIQQMSASILTSFVERLDDDLTKSLQSTDVHSDEYKERLGKSIDILALLWRTFCFLDER 65 +E + + + L SF+ERLD + K+LQ TDVHS EYK+RL +S+ +LALLWR + +ER Sbjct 472 KEQDKSTVTFLVSFIERLDGESLKALQLTDVHSSEYKDRLVQSLHLLALLWRCYKICEER 531 Query 66 GFKAQAATVALKVNEHMHYKPDTIASKMWDVLRKELAETVS 106 G+ +++++ + +H+K D++A K+W+ +R+ L +TV+ Sbjct 532 GYYDLVSSLSVHLINQLHFKNDSLAIKVWEFVRQILEKTVN 572 Lambda K H 0.316 0.129 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40588496850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40