bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5409_orf1 Length=69 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_1710 105 5e-22 > 5807.cgd7_1710 Length=763 Score = 105 bits (261), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 46/69 (66%), Positives = 59/69 (85%), Gaps = 0/69 (0%) Query 1 YGVSFPEKKQLKEYLDLLEKAKERDHRLLGNNLSLFFFEPTVSAGPAFWLPEGAKVYNGL 60 YGVSFP+KK+L EYL++LE+AK+RDHRLLG+NL LFFF+ VS G FWLP GA++YN L Sbjct 310 YGVSFPDKKRLDEYLNMLEEAKKRDHRLLGSNLQLFFFDSNVSPGSCFWLPAGARLYNKL 369 Query 61 IEFIREEYQ 69 ++FIR EY+ Sbjct 370 MDFIRNEYR 378 Lambda K H 0.319 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22781900540 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40