bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5375_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_2120 75.5 4e-13 > 5807.cgd8_2120 Length=514 Score = 75.5 bits (184), Expect = 4e-13, Method: Composition-based stats. Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 6/93 (6%) Query 31 IVQETKKMGYCYFRRDLTEEEKRLNAQNKPTKIASPTP----SPQSAGAAGGEPEKSPEG 86 I+QETKKMGYCYF+R+LTE+EK LN Q PT I + + Q + + +KS G Sbjct 291 ILQETKKMGYCYFKRELTEQEKELNRQFTPTLINNKDSYSCGASQQNDLSSADIDKSRVG 350 Query 87 KSISQWNAKGTTYEEKDVSPWARTRFAERLQEA 119 IS WN+KGTT+E+KDVS AR+ L E Sbjct 351 --ISSWNSKGTTFEDKDVSETARSTLKRILLEG 381 Lambda K H 0.306 0.125 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40