bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5359_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP000325-PA 209 2e-53 > 7165.AGAP000325-PA Length=616 Score = 209 bits (532), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 93/154 (60%), Positives = 120/154 (77%), Gaps = 2/154 (1%) Query 1 NAKPFVTHHNDLNTDLYMRVAPELYLKMLTVGGMDKVFEIGKNFRNEGIDMTHNPEFTAC 60 AKPF+THHNDLN DL++R+APELYLKMLTVGG+D+V+EIG+ FRNEGID+THNPEFT C Sbjct 297 TAKPFITHHNDLNMDLFLRIAPELYLKMLTVGGLDRVYEIGRQFRNEGIDLTHNPEFTTC 356 Query 61 EFYWAYADYNDTMRLTEDMISEMVMSIHGSYKIPFHPEGPNGPVVELDFTPPYRRLSLVE 120 EFY AYADYND + +T+ ++S MV +IHGSYK+ +HP+GP G E+DFTPP+RR+S++ Sbjct 357 EFYMAYADYNDIIDITQQLLSGMVHAIHGSYKVKYHPDGPEGDEYEIDFTPPFRRISMIS 416 Query 121 EIEKQAKVTLPRP--LDGPECLACLKDLMEKHNI 152 +E+ KVT P L PE + L L KH + Sbjct 417 SLEEALKVTFPAADQLHTPEAVQFLDALCVKHEV 450 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40