bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5219_orf2 Length=158 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0044 124 9e-28 > 5833.PF13_0044 Length=2375 Score = 124 bits (311), Expect = 9e-28, Method: Composition-based stats. Identities = 65/135 (48%), Positives = 83/135 (61%), Gaps = 9/135 (6%) Query 1 EALARGYSVERLHELTHIDPWFLSKLEHIQQLKESLSKVSPAQLTSADLFYVKKYGFSDR 60 +A ++++HELTHID WFL K +I L+ L + QL+ DL Y KK+GFSD+ Sbjct 1105 QAFHLNMPMDKIHELTHIDYWFLHKFYNIYNLQNKLKTLKLEQLSFNDLKYFKKHGFSDK 1164 Query 61 QIASYVGGGP---------VEGLRVTEEDVWRYRKALVVEPYIKRIDTLAAEFPAQTNYL 111 QIA Y+ + RVTE DV +YR+ L + P+IK IDTL+AEFPA TNYL Sbjct 1165 QIAHYLSFNTSDNNNNNNNISSCRVTENDVMKYREKLGLFPHIKVIDTLSAEFPALTNYL 1224 Query 112 YLTYHGVVDDVEPLN 126 YLTY G DV PLN Sbjct 1225 YLTYQGQEHDVLPLN 1239 Lambda K H 0.316 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 25621323489 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40