bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5143_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value 51511.ENSCSAVP00000003020 109 2e-23 > 51511.ENSCSAVP00000003020 Length=1454 Score = 109 bits (273), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 63/117 (53%), Positives = 79/117 (67%), Gaps = 6/117 (5%) Query 3 CLNTIGSYECECKDGYGHMEGNACSDIDECSEASTEIPENCNCANTEGSYVCTCNPGYEP 62 C+N GSY CEC+DGY H +G +C D+DECS + E EN C N +GSY+C C GY Sbjct 1033 CINNKGSYSCECRDGY-HGDGKSCEDVDECS-TTNECHENAICINNQGSYLCECRDGYHG 1090 Query 63 ASSDGHACKDVDECAAGTAECHVSAQCVNVDGSYECHCLEGFIGDGKVCSDVDECAA 119 DG +C DVDEC+ T ECHV+A C+N +GSY C C +G+ GDGK C DVDEC+ Sbjct 1091 ---DGKSCDDVDECST-TNECHVNAICINHEGSYSCECRDGYRGDGKSCDDVDECST 1143 Lambda K H 0.316 0.132 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40