bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5078_orf1 Length=74 Score E Sequences producing significant alignments: (Bits) Value 167879.CPS_2808 107 8e-23 > 167879.CPS_2808 Length=872 Score = 107 bits (268), Expect = 8e-23, Method: Composition-based stats. Identities = 48/66 (72%), Positives = 53/66 (80%), Gaps = 0/66 (0%) Query 9 YFHNWTGNRVTVRDWFQLTLKEGLTVFREQLFMGSVLSAGVQRIQEVADLISRQFAEDDG 68 YFHNWTGNRVT RDWFQL+LKEGLTVFR+Q F + S+ V RIQ V L S+QFAED G Sbjct 308 YFHNWTGNRVTCRDWFQLSLKEGLTVFRDQQFSAQMHSSAVTRIQNVRVLRSQQFAEDAG 367 Query 69 PMAHPI 74 PMAHPI Sbjct 368 PMAHPI 373 Lambda K H 0.323 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22434241900 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40