bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5010_orf1 Length=198 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1110c 92.4 7e-18 > 5833.PFF1110c Length=786 Score = 92.4 bits (228), Expect = 7e-18, Method: Composition-based stats. Identities = 47/148 (31%), Positives = 70/148 (47%), Gaps = 21/148 (14%) Query 30 KVRRRCLRWPDCPFGPKCNFIHPAIRCANFPRCPFGASCFYLHPPVKCRYGQNCQNPSCN 89 K++++CL P+C FG KC +IHP C N+P C FG+ C Y+HP V C++G C N CN Sbjct 544 KIQKKCLYLPNCQFGDKCRYIHPVENCRNWPYCAFGSECIYIHPNVPCKFGIYCTNYYCN 603 Query 90 FQHPE-RPGWMGELGEDGLFRNK--VWTKDSQTAAPSETAPNPGGGASTAQQNA------ 140 + H + E+G +G F NK + T D + N S + Sbjct 604 YSHDHVDTTNLPEIGTNGYFLNKKLINTADKNITTNNNNNNNSNNNNSNNNNSNNNNSNN 663 Query 141 ------------AVAALSFTLPSTPPSL 156 VA +S+++P TPP + Sbjct 664 DCVNNEETNFKDTVAQISYSMPKTPPEM 691 Lambda K H 0.318 0.132 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46549540124 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40