bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4978_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0214943 99.8 2e-20 > 44689.DDB_0214943 Length=678 Score = 99.8 bits (247), Expect = 2e-20, Method: Composition-based stats. Identities = 44/102 (43%), Positives = 62/102 (60%), Gaps = 0/102 (0%) Query 1 ADGRVNFMANEFAHPDGLDLPRPANHFSMAKAFRRWNLAESPALKFTQCELFDSCLNHWE 60 DG +NFM NEF HP+ +D PR N+ S+ A RRW+L +P L++ Q FD +N E Sbjct 511 GDGYLNFMGNEFGHPEWVDFPREGNNNSLHHARRRWDLYRNPLLRYKQLRDFDIAMNKAE 570 Query 61 SVFRWQSAAHLYVVKCDEEAQVVVLERGSCLFAFNFHPHNSY 102 FRW S+ Y+ E+ +++V ER S +F FNFHP S+ Sbjct 571 QEFRWLSSDFAYISLKHEDDKIIVFERASLIFIFNFHPSKSF 612 Lambda K H 0.326 0.135 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40