bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4738_orf1 Length=155 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_500 98.6 5e-20 > 5807.cgd6_500 Length=1967 Score = 98.6 bits (244), Expect = 5e-20, Method: Composition-based stats. Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 0/102 (0%) Query 43 DHTLLATCLIHCADISNPLLPERRNMQWASLIIQEFNAQVEMERHKGLPVTVFMDARTEL 102 D L L+H ADISNP+ P +W+SLI++EFN Q ++E GLP+T FMD + ++ Sbjct 1733 DKEFLIETLLHAADISNPITPFPICAKWSSLIVEEFNYQSKLESQFGLPITPFMDLKDDI 1792 Query 103 LRTQSQIGFLSFVVLDQFRALSDLVPGAEELVVQGEKNLEDW 144 + ++QIGFL F+++ Q++ LS ++P + L+ Q EKN E W Sbjct 1793 TKIEAQIGFLEFIIIPQWKLLSRIIPKSIILLKQAEKNRELW 1834 Lambda K H 0.319 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40