bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4540_orf2 Length=206 Score E Sequences producing significant alignments: (Bits) Value 5518.FG04186.1 82.4 8e-15 > 5518.FG04186.1 Length=834 Score = 82.4 bits (202), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 0/90 (0%) Query 5 VLLQLFVKCVARRYGVLEVFLEGGRSKTGLMLPPKLGLLSCAADMLFSGSVSEVLFIPIS 64 L+Q ++ + + E F+EGGRS+TG +LPPK G+LS D + SG V + + P+S Sbjct 275 TLVQSYIDTLLQEGYNFECFIEGGRSRTGKLLPPKFGILSFVLDSILSGRVQDAIICPVS 334 Query 65 ISYDRVLEAETFPQELLGEPKKAEGLSRVL 94 YD+V+E E + ELLG PKK E L+ L Sbjct 335 TQYDKVIETEGYVTELLGMPKKKENLADFL 364 Lambda K H 0.322 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 51449491716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40