bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4538_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G05990.2 82.4 3e-15 > 3702.AT2G05990.2 Length=390 Score = 82.4 bits (202), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 45/100 (45%), Positives = 58/100 (58%), Gaps = 19/100 (19%) Query 48 LRPTAAVPTASQQQQPVQQVAVVPRGVSSSSSSSTAAAAGPTGTAEPLSGPLPVDLRGKT 107 LR +AVPT + P S+ + S ++ P+G LP+DLRGK Sbjct 56 LRNHSAVPTCKR-----------PFSFSTRAMSESSENKAPSG--------LPIDLRGKR 96 Query 108 AFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFK 147 AF+AG+AD NGYGWAI K L AAGA +LVGTW P +IF+ Sbjct 97 AFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFE 136 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40