bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4525_orf1 Length=204 Score E Sequences producing significant alignments: (Bits) Value 9598.ENSPTRP00000007324 154 1e-36 > 9598.ENSPTRP00000007324 Length=875 Score = 154 bits (390), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 77/193 (39%), Positives = 117/193 (60%), Gaps = 26/193 (13%) Query 12 QQQQHQQQGLLKQTYMVVNEKHKTSALFSILRAQCKKKIIVFVSSCKQAKFIHDAFKQLK 71 ++ ++ L+Q Y+V K K S L+S LR+ KKK IVF SSCK+ ++++ F +L+ Sbjct 278 EKAKYSTPATLEQNYIVCELKQKISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLR 337 Query 72 PGLSLLYLHGRQKQQKRLDVFHDFVSRTSPCCLISTDLAARGIDFVQSGGLLGSAGGSRK 131 PG+S+L LHGRQ+Q +R++V+++FV R L +TD+AARG+DF Sbjct 338 PGVSILALHGRQQQMRRMEVYNEFV-RKRAAVLFATDIAARGLDF--------------- 381 Query 132 KKQEEAEGALSAVDLVIQFDCPDSTETHLHRIGRTARLTRKGHAVLLLLPSEASFVLELQ 191 AV+ V+QFDCP+ T++HR GRTAR G A+L+LLPSE + V +L Sbjct 382 ----------PAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILLPSEKAMVQQLL 431 Query 192 AKGMVLQRINMNP 204 K + ++ I +NP Sbjct 432 QKKVPVKEIKINP 444 Lambda K H 0.320 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 50224503818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40