bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4520_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 4896.SPAC13D1.02 78.2 6e-14 > 4896.SPAC13D1.02 Length=1333 Score = 78.2 bits (191), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 47/118 (39%), Positives = 68/118 (57%), Gaps = 6/118 (5%) Query 9 ENETQVLQFLSTINYCRMFMGPDYADVARPLFNLTRKDVNFKWTDLHTQAVRQPKQRVLD 68 +N ++ QFL ++NY R F+ P + + PL NL +KDV +KWT TQA+ KQ ++ Sbjct 637 KNRKELRQFLGSVNYLRKFI-PKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVS 695 Query 69 FTTLQVSDTTKPFELYTDASSYAIGAVVEQ---DGK--PIGFLSQVMNPTQQRYSMYD 121 L+ D +K L TDAS A+GAV+ Q D K P+G+ S M+ Q YS+ D Sbjct 696 PPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSD 753 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40